Doodle

1,830 Coloring Pages of Pollinator

plantsflowerspollinator-friendlyperennialgardensanimalswildflowerinsectstropicalbiodiversity
Caterpillar and Buttefly from Caterpillar
Larkspur Flower from Larkspur
Rhododendron Calendulaceum or Flame Azalea from Azalea
Hemerocallis Spp or Day Lily from Perennial
Ipomoea Tuberosa Hawaiian Woodrose from Roses
Orchids from Orchid
Flower Poppy from Red
Europeana Floribunda Rose from Roses
Lavender from Plants ii coloring book
Bee from Cartoon animals coloring book
Butterfly from Cartoon animals viii coloring book
Daffodil from Daffodil
Steampunk Bee from Steampunk animals coloring book
Apple Blossom Branch from Apple tree
Annual Hibiscus (Abelmoschus Moschatus) from Hawaii flower
Fireweed or Rosebay Willowherb from Celebrating wildflowers coloring book
Cosmos Scabiosoides from Cosmos
Bee from Cartoon animals v coloring book
Swallow Tail Hummingbird from Hummingbirds
Bumblebee from Woodland animals
Bee from Cartoon animals viii coloring book
Spring Crocus from Crocus
Heliconia Indica from Heliconia
Black Raspberry from Celebrating wildflowers coloring book
Common Fruit Bats from Realistic animals coloring book
Butterfly from Cartoon animals vii coloring book
Hibiscus Flower from Hawaii flower
Chinese Peony from Flowers
Cherokee Rose from Roses
Bug from Animals
Hibiscus from Realistic flowers
Pollinators of Alaska from Nps
Orchid Lycaste Aromatica from Orchid
Chrysanthemum 1 from Perennial
Iris Motif from Iris
Epigaea Repens or Mayflower or Trailing Arbutus from Leaves
Delphinium Trolliifolium or Columbian Larkspur from Larkspur
Iris Flower Blossom from Iris
Disa Kewensis Orchid from Orchid
Black Elderberry from Elderberry
Double Delight Hybrid Tea Rose from Roses
Ladybug from Cartoon animals coloring book
Butterfly from Cartoon animals coloring book
American Twinflower from Celebrating wildflowers coloring book
Realistic Ruby Throated Hummingbird from Hummingbirds
Bumblebee from Bumblebee
Ladybug from Cartoon animals viii coloring book
Ladybug from Cartoon animals v coloring book
Daisy from Simple objects iv coloring book
Realistic Sunflowers from Sunflower
Bumblebee from Simple objects coloring book
Saskatoon from Serviceberry
Grasshopper on the Flower from Grasshoppers
Masdevallia Coccinea Orchid from Orchid
Renanthera Imschootiana Orchid from Orchid
Rabbit Smelling Tulip from Grass
Hyacinth Flower from Hyacinthus
Aquilegia Truncata Red Columbine from Columbine
Viola Adunca or Pale Mountain Violet from Violet
Clarkia Amoena Farewell to Spring from Godetia
Daffodil Flowers from Daffodil
Schlumbergera Bloom from Cactus
Dianthus Caryophyllus Clove Pink Carnation from Carnation
Cochlospermum Vitifolium or Buttercup Tree from Buttercup
Cirsium Vulgare or Bull Thistle from Thistle
Oriental poppy from Perennial
Hummingbird from Cartoon animals ii coloring book
Cornflower, Blue Bottle from Cornflowers
Heliconia Psittacorum from Heliconia
Bluebell Bellflower from Bellflower
Aster or Star Plant from Asters
Chinese Bellflower (Platycodon Grandiflorus) from Bellflower
Ranunculus Acris from Buttercup
Tall Mountain Bluebells from Celebrating wildflowers coloring book
Burke's Larkspur from Celebrating wildflowers coloring book
Scarlet Carnation from Carnation
Cute Butterfly Flies over the Swamp from Cute butterflies coloring book
Butterfly Flies On A Flower from Flowers
Black Locust from Locust tree
Giant Red Indian Paintbrush from Celebrating wildflowers coloring book
Hiker's Gentian Or Explorer's Gentian from Celebrating wildflowers coloring book
Life Cycle of Monarch Butterfly from Biology
Yellow Edged Giant Owl Butterfly from Butterfly
Daffodil from Daffodil
Big-Headed Clover from Celebrating wildflowers coloring book
Anemone Coronaria from Anemone
Blooming Sunflower from Sunflower
Pink Hibiscus from Realistic flowers
Chrysanthemum Morifolium from Flower garden
Chrysanthemum Carinatum from Realistic flowers
Wildflower from Plants ii coloring book
Bug from Cartoon animals coloring book
Tropical Vanda Tricolor Orchid from Orchid
Common Evening Primrose or Evening Star from Primrose
Aster 1 from Asters
Grasshopper on Flower from Grasshoppers
ʻIʻiwi - Hawaiian Honeycreeper from Hawaii
Cornflower from Cornflowers
Grasshopper in Garden from Grasshoppers
Sophronitis Cernua Orchid from Orchid
201 - 300 of 1,830 Next page
/ 19